FGF21 anticorps (N-Term)

N° du produit ABIN634771

Détail du produit anti-FGF21 anticorps

Antigène: FGF21 (Fibroblast Growth Factor 21 (FGF21))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FGF21 est non-conjugé

Application: Western Blotting (WB)

Specificité: FGF21 antibody was raised against the N terminal of FGF21

Purification: Affinity purified

Immunogène: FGF21 antibody was raised using the N terminal of FGF21 corresponding to a region with amino acids DSDETGFEHSGLWVSVLAGLLLGACQAHPIPDSSPLLQFGGQVRQRYLYT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FGF21 Blocking Peptide, catalog no. 33R-2157, is also available for use as a blocking control in assays to test for specificity of this FGF21 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FGF21 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FGF21

Antigène: FGF21 (Fibroblast Growth Factor 21 (FGF21))

Autre désignation: FGF21 (FGF21 Produits)

Synonymes: anticorps FGF21, anticorps fibroblast growth factor 21, anticorps FGF21, anticorps fgf21, anticorps Fgf21

Sujet: FGF21 is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. The function of this growth factor has not yet been determined.

Poids moléculaire: 19 kDa (MW of target protein)

Pathways: Signalisation RTK