LONRF2 anticorps (Middle Region)

N° du produit ABIN634772

Détail du produit anti-LONRF2 anticorps

Antigène: LONRF2 (LON Peptidase N-terminal Domain and Ring Finger 2 (LONRF2))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LONRF2 est non-conjugé

Application: Western Blotting (WB)

Specificité: LONRF2 antibody was raised against the middle region of LONRF2

Purification: Affinity purified

Immunogène: LONRF2 antibody was raised using the middle region of LONRF2 corresponding to a region with amino acids FGMCLSAEHAGLSEYGCMLEIKDVRTFPDGSSVVDAIGISRFRVLSHRHR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LONRF2 Blocking Peptide, catalog no. 33R-2908, is also available for use as a blocking control in assays to test for specificity of this LONRF2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LONRF2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LONRF2

Antigène: LONRF2 (LON Peptidase N-terminal Domain and Ring Finger 2 (LONRF2))

Autre désignation: LONRF2 (LONRF2 Produits)

Synonymes: anticorps RGD1562137, anticorps AI851349, anticorps 2900060P06Rik, anticorps LONRF2, anticorps RNF192, anticorps LON peptidase N-terminal domain and ring finger 2, anticorps Lonrf2, anticorps LONRF2, anticorps lonrf2

Sujet: LONRF2 contains 1 Lon domain,1 RING-type zinc finger and 6 TPR repeats. The function of the LONRF2 protein remains unknown.

Poids moléculaire: 84 kDa (MW of target protein)