BMP6 anticorps (Middle Region)

N° du produit ABIN634774

Détail du produit anti-BMP6 anticorps

Antigène: BMP6 (Bone Morphogenetic Protein 6 (BMP6))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp BMP6 est non-conjugé

Application: Western Blotting (WB)

Specificité: BMP6 antibody was raised against the middle region of BMP6

Purification: Affinity purified

Immunogène: BMP6 antibody was raised using the middle region of BMP6 corresponding to a region with amino acids MVAFFKVSEVHVRTTRSASSRRRQQSRNRSTQSQDVARVSSASDYNSSEL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

BMP6 Blocking Peptide, catalog no. 33R-6576, is also available for use as a blocking control in assays to test for specificity of this BMP6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BMP6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur BMP6

Antigène: BMP6 (Bone Morphogenetic Protein 6 (BMP6))

Autre désignation: BMP6 (BMP6 Produits)

Synonymes: anticorps BMP6, anticorps zgc:113595, anticorps vgr, anticorps vgr-1, anticorps vgr1, anticorps VGR, anticorps VGR1, anticorps D13Wsu115e, anticorps Vgr1, anticorps bone morphogenetic protein 6, anticorps bone morphogenetic protein 6 S homeolog, anticorps BMP6, anticorps bmp6, anticorps bmp6.S, anticorps Bmp6

Sujet: The bone morphogenetic proteins (BMPs) are a family of secreted signaling molecules that can induce ectopic bone growth. Many BMPs are part of the transforming growth factor-beta (TGFB) superfamily.

Poids moléculaire: 57 kDa (MW of target protein)

Pathways: Regulation of Hormone Metabolic Process, Regulation of Hormone Biosynthetic Process