OSGIN1 anticorps (N-Term)
-
- Antigène Voir toutes OSGIN1 Anticorps
- OSGIN1 (Oxidative Stress Induced Growth Inhibitor 1 (OSGIN1))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp OSGIN1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- OSGIN1 antibody was raised against the N terminal of OSGIN1
- Purification
- Affinity purified
- Immunogène
- OSGIN1 antibody was raised using the N terminal of OSGIN1 corresponding to a region with amino acids APGVSILDQDLDYLSEGLEGRSQSPVALLFDALLRPDTDFGGNMKSVLTW
- Top Product
- Discover our top product OSGIN1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
OSGIN1 Blocking Peptide, catalog no. 33R-1422, is also available for use as a blocking control in assays to test for specificity of this OSGIN1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OSGIN1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- OSGIN1 (Oxidative Stress Induced Growth Inhibitor 1 (OSGIN1))
- Autre désignation
- OSGIN1 (OSGIN1 Produits)
- Synonymes
- anticorps 1700012B18Rik, anticorps Okl38, anticorps 1700012B18RIK, anticorps BDGI, anticorps OKL38, anticorps oxidative stress induced growth inhibitor 1, anticorps OSGIN1, anticorps Osgin1
- Sujet
- OSGIN1 regulates the differentiation and proliferation of normal cells through the regulation of cell death.
- Poids moléculaire
- 61 kDa (MW of target protein)
-