OSGIN1 anticorps (N-Term)

N° du produit ABIN634776

Détail du produit anti-OSGIN1 anticorps

Antigène: OSGIN1 (Oxidative Stress Induced Growth Inhibitor 1 (OSGIN1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp OSGIN1 est non-conjugé

Application: Western Blotting (WB)

Specificité: OSGIN1 antibody was raised against the N terminal of OSGIN1

Purification: Affinity purified

Immunogène: OSGIN1 antibody was raised using the N terminal of OSGIN1 corresponding to a region with amino acids APGVSILDQDLDYLSEGLEGRSQSPVALLFDALLRPDTDFGGNMKSVLTW

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

OSGIN1 Blocking Peptide, catalog no. 33R-1422, is also available for use as a blocking control in assays to test for specificity of this OSGIN1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OSGIN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur OSGIN1

Antigène: OSGIN1 (Oxidative Stress Induced Growth Inhibitor 1 (OSGIN1))

Autre désignation: OSGIN1 (OSGIN1 Produits)

Synonymes: anticorps 1700012B18Rik, anticorps Okl38, anticorps 1700012B18RIK, anticorps BDGI, anticorps OKL38, anticorps oxidative stress induced growth inhibitor 1, anticorps OSGIN1, anticorps Osgin1

Sujet: OSGIN1 regulates the differentiation and proliferation of normal cells through the regulation of cell death.

Poids moléculaire: 61 kDa (MW of target protein)