COPA anticorps (N-Term)

N° du produit ABIN634777

Détail du produit anti-COPA anticorps

Antigène: COPA (Coatomer Protein Complex, Subunit alpha (COPA))

Épitope: N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp COPA est non-conjugé

Application: Western Blotting (WB)

Specificité: COPA antibody was raised against the N terminal of COPA

Purification: Affinity purified

Immunogène: COPA antibody was raised using the N terminal of COPA corresponding to a region with amino acids PWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFHKQQPLFVSGGD

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

COPA Blocking Peptide, catalog no. 33R-7432, is also available for use as a blocking control in assays to test for specificity of this COPA antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COPA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur COPA

Antigène: COPA (Coatomer Protein Complex, Subunit alpha (COPA))

Autre désignation: COPA (COPA Produits)

Synonymes: anticorps COPA, anticorps DDBDRAFT_0189693, anticorps DDBDRAFT_0233797, anticorps DDB_0189693, anticorps DDB_0233797, anticorps DKFZp469O221, anticorps AU040324, anticorps xenin, anticorps HEP-COP, anticorps cb281, anticorps fb13c12, anticorps wu:fb13c12, anticorps coatomer protein complex subunit alpha, anticorps WD40 repeat-containing protein, anticorps Coatomer subunit alpha, anticorps coatomer protein complex, subunit alpha, anticorps coatomer protein complex subunit alpha L homeolog, anticorps COPA, anticorps copA, anticorps cgd8_860, anticorps Chro.80105, anticorps AFUA_3G08840, anticorps copa, anticorps Copa, anticorps copa.L

Sujet: In eukaryotic cells, protein transport between the endoplasmic reticulum and Golgi compartments is mediated in part by non-clathrin-coated vesicular coat proteins (COPs). The alpha-COP, encoded by COPA, shares high sequence similarity with RET1P, the alpha subunit of the coatomer complex in yeast. Also, the N-terminal 25 amino acids of alpha-COP encode the bioactive peptide, xenin, which stimulates exocrine pancreatic secretion and may act as a gastrointestinal hormone.

Poids moléculaire: 135 kDa (MW of target protein)

Pathways: Hormone Activity