Norrie Disease (Pseudoglioma) anticorps

N° du produit ABIN634783

Détail du produit anti-Norrie Disease (Pseudoglioma) anticorps

Antigène: Norrie Disease (Pseudoglioma) (NDP)

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Norrie Disease (Pseudoglioma) est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: NDP antibody was raised using a synthetic peptide corresponding to a region with amino acids DPRRCMRHHYVDSISHPLYKCSSKMVLLARCEGHCSQASRSEPLVSFSTV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NDP Blocking Peptide, catalog no. 33R-2114, is also available for use as a blocking control in assays to test for specificity of this NDP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NDP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Norrie Disease (Pseudoglioma)

Antigène: Norrie Disease (Pseudoglioma) (NDP)

Autre désignation: NDP (NDP Produits)

Synonymes: anticorps EVR2, anticorps FEVR, anticorps ND, anticorps evr2, anticorps fevr, anticorps xnorrin, anticorps Ndph, anticorps RGD1563968, anticorps NDP, norrin cystine knot growth factor, anticorps Norrie disease (pseudoglioma) L homeolog, anticorps Norrie disease (pseudoglioma) (human), anticorps NDP, anticorps ndp.L, anticorps Ndp

Sujet: NDP activates the canonical Wnt signaling pathway through FZD4 and LRP5 coreceptor. NDP plays a central role in retinal vascularization by acting as a ligand for FZD4 that signals via stabilizing beta-catenin (CTNNB1) and activating LEF/TCF-mediated transcriptional programs. NDP acts in concert with TSPAN12 to activate FZD4 independently of the Wnt-dependent activation of FZD4, suggesting the existence of a Wnt-independent signaling that also promote accumulation the beta-catenin (CTNNB1).

Poids moléculaire: 15 kDa (MW of target protein)

Pathways: Sensory Perception of Sound