PDGFD anticorps (N-Term)

N° du produit ABIN634793

Détail du produit anti-PDGFD anticorps

Antigène: PDGFD (Platelet Derived Growth Factor D (PDGFD))

Épitope: N-Term

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PDGFD est non-conjugé

Application: Western Blotting (WB)

Specificité: PDGFD antibody was raised against the N terminal of PDGFD

Purification: Affinity purified

Immunogène: PDGFD antibody was raised using the N terminal of PDGFD corresponding to a region with amino acids NANLRRDESNHLTDLYRRDETIQVKGNGYVQSPRFPNSYPRNLLLTWRLH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PDGFD Blocking Peptide, catalog no. 33R-6641, is also available for use as a blocking control in assays to test for specificity of this PDGFD antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDGFD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PDGFD

Antigène: PDGFD (Platelet Derived Growth Factor D (PDGFD))

Autre désignation: PDGFD (PDGFD Produits)

Synonymes: anticorps IEGF, anticorps SCDGF-B, anticorps SCDGFB, anticorps Scdgfb, anticorps rSCDGF-B, anticorps PDGFD, anticorps 1110003I09Rik, anticorps platelet derived growth factor D, anticorps platelet-derived growth factor, D polypeptide, anticorps PDGFD, anticorps Pdgfd

Sujet: The protein encoded by this gene is a member of the platelet-derived growth factor family. The four members of this family are mitogenic factors for cells of mesenchymal origin and are characterized by a core motif of eight cysteines.

Poids moléculaire: 40 kDa (MW of target protein)

Pathways: Signalisation RTK, Platelet-derived growth Factor Receptor Signaling