LEFTY1 anticorps (N-Term)
-
- Antigène Voir toutes LEFTY1 Anticorps
- LEFTY1 (Left-Right Determination Factor 1 (LEFTY1))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp LEFTY1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- LEFTY1 antibody was raised against the N terminal of LEFTY1
- Purification
- Affinity purified
- Immunogène
- LEFTY1 antibody was raised using the N terminal of LEFTY1 corresponding to a region with amino acids MQPLWLCWALWVLPLASPGAALTGEQLLGSLLRQLQLKEVPTLDRADMEE
- Top Product
- Discover our top product LEFTY1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
LEFTY1 Blocking Peptide, catalog no. 33R-6338, is also available for use as a blocking control in assays to test for specificity of this LEFTY1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LEFTY1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- LEFTY1 (Left-Right Determination Factor 1 (LEFTY1))
- Autre désignation
- LEFTY1 (LEFTY1 Produits)
- Synonymes
- anticorps atv, anticorps cb73, anticorps antivin, anticorps ik:tdsubc_2b12, anticorps xx:tdsubc_2b12, anticorps LEFTY1, anticorps AI450052, anticorps Ebaf, anticorps Leftb, anticorps Stra3, anticorps Tgfb4, anticorps lefty, anticorps lefty-1, anticorps RGD1561867, anticorps LEFTB, anticorps LEFTYB, anticorps lefty1, anticorps signaling molecule lefty1, anticorps left-right determination factor 1, anticorps left right determination factor 1, anticorps lft1, anticorps lefty1, anticorps LOC699924, anticorps LEFTY1, anticorps LOC100408003, anticorps LOC100597378, anticorps Lefty1
- Sujet
- LEFTY1 is a member of the TGF-beta family of proteins. A similar secreted protein in mouse plays a role in left-right asymmetry determination of organ systems during development.
- Poids moléculaire
- 11 kDa (MW of target protein)
-