AMH anticorps (Middle Region)
-
- Antigène Voir toutes AMH Anticorps
- AMH (Anti-Mullerian Hormone (AMH))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp AMH est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- AMH antibody was raised against the middle region of AMH
- Purification
- Affinity purified
- Immunogène
- AMH antibody was raised using the middle region of AMH corresponding to a region with amino acids SVDLRAERSVLIPETYQANNCQGVCGWPQSDRNPRYGNHVVLLLKMQARG
- Top Product
- Discover our top product AMH Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
AMH Blocking Peptide, catalog no. 33R-8906, is also available for use as a blocking control in assays to test for specificity of this AMH antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AMH antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- AMH (Anti-Mullerian Hormone (AMH))
- Autre désignation
- AMH (AMH Produits)
- Synonymes
- anticorps AMH, anticorps amh, anticorps MIF, anticorps MIS, anticorps anti-Mullerian hormone, anticorps amh, anticorps AMH, anticorps Amh
- Sujet
- Anti-Mullerian hormone is a member of the transforming growth factor-beta gene family which mediates male sexual differentiation. Anti-Mullerian hormone causes the regression of Mullerian ducts which would otherwise differentiate into the uterus and fallopian tubes. Some mutations in the anti-Mullerian hormone result in persistent Mullerian duct syndrome.
- Poids moléculaire
- 57 kDa (MW of target protein)
- Pathways
- Negative Regulation of Hormone Secretion
-