LEFTY2 anticorps (N-Term)
-
- Antigène Voir toutes LEFTY2 Anticorps
- LEFTY2 (Left-Right Determination Factor 2 (LEFTY2))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp LEFTY2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- LEFTY2 antibody was raised against the N terminal of LEFTY2
- Purification
- Affinity purified
- Immunogène
- LEFTY2 antibody was raised using the N terminal of LEFTY2 corresponding to a region with amino acids MWPLWLCWALWVLPLAGPGAALTEEQLLGSLLRQLQLSEVPVLDRADMEK
- Top Product
- Discover our top product LEFTY2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
LEFTY2 Blocking Peptide, catalog no. 33R-6619, is also available for use as a blocking control in assays to test for specificity of this LEFTY2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LEFTY2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- LEFTY2 (Left-Right Determination Factor 2 (LEFTY2))
- Autre désignation
- LEFTY2 (LEFTY2 Produits)
- Sujet
- LEFTY2 is a member of the TGF-beta family of proteins. The protein is secreted and plays a role in left-right asymmetry determination of organ systems during development. The protein may also play a role in endometrial bleeding. Mutations in its gene have been associated with left-right axis malformations, particularly in the heart and lungs. Some types of infertility have been associated with dysregulated expression of its gene in the endometrium.
- Poids moléculaire
- 40 kDa (MW of target protein)
-