LEFTY2 anticorps (N-Term)

N° du produit ABIN634801

Détail du produit anti-LEFTY2 anticorps

Antigène: LEFTY2 (Left-Right Determination Factor 2 (LEFTY2))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LEFTY2 est non-conjugé

Application: Western Blotting (WB)

Specificité: LEFTY2 antibody was raised against the N terminal of LEFTY2

Purification: Affinity purified

Immunogène: LEFTY2 antibody was raised using the N terminal of LEFTY2 corresponding to a region with amino acids MWPLWLCWALWVLPLAGPGAALTEEQLLGSLLRQLQLSEVPVLDRADMEK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LEFTY2 Blocking Peptide, catalog no. 33R-6619, is also available for use as a blocking control in assays to test for specificity of this LEFTY2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LEFTY2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LEFTY2

Antigène: LEFTY2 (Left-Right Determination Factor 2 (LEFTY2))

Autre désignation: LEFTY2 (LEFTY2 Produits)

Synonymes: anticorps EBAF, anticorps LEFTA, anticorps LEFTYA, anticorps TGFB4, anticorps AI450052, anticorps Ebaf, anticorps Leftb, anticorps Stra3, anticorps Tgfb4, anticorps lefty, anticorps lefty-1, anticorps atv2, anticorps cb720, anticorps fe38b03, anticorps wu:fe38b03, anticorps 6030463A22Rik, anticorps AV214969, anticorps Lefta, anticorps Ebaf2, anticorps left-right determination factor 2, anticorps left right determination factor 1, anticorps lefty2, anticorps Left-right determination factor 2, anticorps left-right determination factor 2-like, anticorps LEFTY2, anticorps Lefty1, anticorps lft2, anticorps Lefty2, anticorps LOC699676, anticorps LOC100232580

Sujet: LEFTY2 is a member of the TGF-beta family of proteins. The protein is secreted and plays a role in left-right asymmetry determination of organ systems during development. The protein may also play a role in endometrial bleeding. Mutations in its gene have been associated with left-right axis malformations, particularly in the heart and lungs. Some types of infertility have been associated with dysregulated expression of its gene in the endometrium.

Poids moléculaire: 40 kDa (MW of target protein)