IL-5 anticorps
-
- Antigène Voir toutes IL-5 (IL5) Anticorps
- IL-5 (IL5) (Interleukin 5 (IL5))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp IL-5 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- IL5 antibody was raised using a synthetic peptide corresponding to a region with amino acids LESQTVQGGTVERLFKNLSLIKKYIDGQKKKCGEERRRVNQFLDYLQEFL
- Top Product
- Discover our top product IL5 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
IL5 Blocking Peptide, catalog no. 33R-4928, is also available for use as a blocking control in assays to test for specificity of this IL5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- IL-5 (IL5) (Interleukin 5 (IL5))
- Autre désignation
- IL5 (IL5 Produits)
- Synonymes
- anticorps EDF, anticorps IL-5, anticorps TRF, anticorps Il-5, anticorps IL5, anticorps interleukin 5, anticorps IL5, anticorps Il5
- Sujet
- IL5 is a cytokine that acts as a growth and differentiation factor for both B cells and eosinophils. This cytokine is a main regulator of eosinopoiesis, eosinophil maturation and activation. The elevated production of this cytokine is reported to be related to asthma or hypereosinophilic syndromes.
- Poids moléculaire
- 13 kDa (MW of target protein)
- Pathways
- Signalistation JAK/STAT, Positive Regulation of Peptide Hormone Secretion, Production of Molecular Mediator of Immune Response, Feeding Behaviour
-