IL-9 anticorps (Middle Region)
-
- Antigène Voir toutes IL-9 (IL9) Anticorps
- IL-9 (IL9) (Interleukin 9 (IL9))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp IL-9 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- IL9 antibody was raised against the middle region of IL9
- Purification
- Affinity purified
- Immunogène
- IL9 antibody was raised using the middle region of IL9 corresponding to a region with amino acids SQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALT
- Top Product
- Discover our top product IL9 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
IL9 Blocking Peptide, catalog no. 33R-8718, is also available for use as a blocking control in assays to test for specificity of this IL9 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL9 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- IL-9 (IL9) (Interleukin 9 (IL9))
- Autre désignation
- IL9 (IL9 Produits)
- Synonymes
- anticorps IL9, anticorps IL-9, anticorps Il-9, anticorps P40, anticorps HP40, anticorps interleukin 9, anticorps IL9, anticorps il9, anticorps Il9
- Sujet
- IL9 is a cytokine that acts as a regulator of a variety of hematopoietic cells. This cytokine stimulates cell proliferation and prevents apoptosis. It functions through the interleukin 9 receptor (IL9R), which activates different signal transducer and activator (STAT) proteins and thus connects this cytokine to various biological processes. The gene encoding IL9 has been identified as a candidate gene for asthma. Genetic studies on a mouse model of asthma demonstrated that IL9 is a determining factor in the pathogenesis of bronchial hyperresponsiveness.
- Poids moléculaire
- 14 kDa (MW of target protein)
- Pathways
- Signalistation JAK/STAT
-