Hepcidin anticorps (N-Term)

N° du produit ABIN634809

Détail du produit anti-Hepcidin anticorps

Antigène: Hepcidin (HAMP) (Hepcidin Antimicrobial Peptide (HAMP))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Hepcidin est non-conjugé

Application: Western Blotting (WB)

Specificité: HAMP antibody was raised against the N terminal of HAMP

Purification: Affinity purified

Immunogène: HAMP antibody was raised using the N terminal of HAMP corresponding to a region with amino acids MALSSQIWAACLLLLLLLASLTSGSVFPQQTGQLAELQPQDRAGARASWM

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HAMP Blocking Peptide, catalog no. 33R-5697, is also available for use as a blocking control in assays to test for specificity of this HAMP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HAMP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Références pour anticorps anti-Hepcidin (ABIN634809)

Blanchette-Farra, Kita, Konstorum, Tesfay, Lemler, Hegde, Claffey, Torti, Torti: "Contribution of three-dimensional architecture and tumor-associated fibroblasts to hepcidin regulation in breast cancer." dans: Oncogene, Vol. 37, Issue 29, pp. 4013-4032, (2019) (PubMed).

Détails sur Hepcidin

Antigène: Hepcidin (HAMP) (Hepcidin Antimicrobial Peptide (HAMP))

Autre désignation: HAMP (HAMP Produits)

Synonymes: anticorps HEPC, anticorps HFE2B, anticorps LEAP1, anticorps PLTR, anticorps Hepcidin, anticorps Hamp1, anticorps Hepc, anticorps Hepc1, anticorps HAMP, anticorps hepcidin, anticorps hamp1, anticorps hep1, anticorps hepcidin antimicrobial peptide, anticorps hepcidin-like, anticorps hepcidin-1, anticorps Ham percentage, anticorps HAMP, anticorps Hamp, anticorps hamp, anticorps LOC100135935, anticorps LOC106584587

Sujet: The product encoded by this gene is involved in the maintenance of iron homeostasis, and it is necessary for the regulation of iron storage in macrophages, and for intestinal iron absorption.

Poids moléculaire: 9 kDa (MW of target protein)

Pathways: Hormone Activity, Transition Metal Ion Homeostasis