Peptide YY anticorps (Middle Region)

N° du produit ABIN634817

Détail du produit anti-Peptide YY anticorps

Antigène: Peptide YY (PYY)

Épitope: Middle Region

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Peptide YY est non-conjugé

Application: Western Blotting (WB)

Specificité: PYY antibody was raised against the middle region of PYY

Purification: Affinity purified

Immunogène: PYY antibody was raised using the middle region of PYY corresponding to a region with amino acids APREDASPEELNRYYASLRHYLNLVTRQRYGKRDGPDTLLSKTFFPDGED

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PYY Blocking Peptide, catalog no. 33R-1436, is also available for use as a blocking control in assays to test for specificity of this PYY antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PYY antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Peptide YY

Antigène: Peptide YY (PYY)

Autre désignation: PYY (PYY Produits)

Synonymes: anticorps PYY-I, anticorps PYY1, anticorps GHYY, anticorps RATGHYY, anticorps Yy, anticorps peptide-YY, anticorps peptide YY, anticorps peptide YY (mapped), anticorps PYY, anticorps Pyy

Sujet: This gut peptide inhibits exocrine pancreatic secretion, has a vasoconstrictory action and inhibitis jejunal and colonic mobility.

Poids moléculaire: 11 kDa (MW of target protein)