TMEM168 anticorps (C-Term)

N° du produit ABIN634819

Détail du produit anti-TMEM168 anticorps

Antigène: TMEM168 (Transmembrane Protein 168 (TMEM168))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMEM168 est non-conjugé

Application: Western Blotting (WB)

Specificité: TMEM168 antibody was raised against the C terminal of TMEM168

Purification: Affinity purified

Immunogène: TMEM168 antibody was raised using the C terminal of TMEM168 corresponding to a region with amino acids EEADPPQLGDFTKDWVEYNCNSSNNICWTEKGRTVKAVYGVSKRWSDYTL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMEM168 Blocking Peptide, catalog no. 33R-2336, is also available for use as a blocking control in assays to test for specificity of this TMEM168 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM168 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMEM168

Antigène: TMEM168 (Transmembrane Protein 168 (TMEM168))

Autre désignation: TMEM168 (TMEM168 Produits)

Synonymes: anticorps tmem168, anticorps si:dkey-192l17.1, anticorps flj13576, anticorps 5730526F17Rik, anticorps 8430437G11Rik, anticorps AI462344, anticorps AI504145, anticorps RGD1307778, anticorps transmembrane protein 168, anticorps transmembrane protein 168a, anticorps transmembrane protein 168 S homeolog, anticorps TMEM168, anticorps tmem168a, anticorps tmem168.S, anticorps Tmem168

Sujet: TMEM168 is a multi-pass membrane protein. It belongs to the TMEM168 family. The exact function of TMEM168 remains unknown.

Poids moléculaire: 80 kDa (MW of target protein)