TMEM168 anticorps (C-Term)
-
- Antigène Tous les produits TMEM168
- TMEM168 (Transmembrane Protein 168 (TMEM168))
-
Épitope
- C-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TMEM168 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- TMEM168 antibody was raised against the C terminal of TMEM168
- Purification
- Affinity purified
- Immunogène
- TMEM168 antibody was raised using the C terminal of TMEM168 corresponding to a region with amino acids EEADPPQLGDFTKDWVEYNCNSSNNICWTEKGRTVKAVYGVSKRWSDYTL
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
TMEM168 Blocking Peptide, catalog no. 33R-2336, is also available for use as a blocking control in assays to test for specificity of this TMEM168 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM168 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TMEM168 (Transmembrane Protein 168 (TMEM168))
- Autre désignation
- TMEM168 (TMEM168 Produits)
- Synonymes
- anticorps tmem168, anticorps si:dkey-192l17.1, anticorps flj13576, anticorps 5730526F17Rik, anticorps 8430437G11Rik, anticorps AI462344, anticorps AI504145, anticorps RGD1307778, anticorps transmembrane protein 168, anticorps transmembrane protein 168a, anticorps transmembrane protein 168 S homeolog, anticorps TMEM168, anticorps tmem168a, anticorps tmem168.S, anticorps Tmem168
- Sujet
- TMEM168 is a multi-pass membrane protein. It belongs to the TMEM168 family. The exact function of TMEM168 remains unknown.
- Poids moléculaire
- 80 kDa (MW of target protein)
-