PODXL anticorps (Middle Region)
-
- Antigène Voir toutes PODXL Anticorps
- PODXL (Podocalyxin-Like (PODXL))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PODXL est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PODXL antibody was raised against the middle region of PODXL
- Purification
- Affinity purified
- Immunogène
- PODXL antibody was raised using the middle region of PODXL corresponding to a region with amino acids PATALRTPTLPETMSSSPTAASTTHRYPKTPSPTVAHESNWAKCEDLETQ
- Top Product
- Discover our top product PODXL Anticorps primaire
-
-
- Indications d'application
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PODXL Blocking Peptide, catalog no. 33R-6983, is also available for use as a blocking control in assays to test for specificity of this PODXL antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PODXL antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PODXL (Podocalyxin-Like (PODXL))
- Autre désignation
- PODXL (PODXL Produits)
- Synonymes
- anticorps Gp200, anticorps PC, anticorps PCLP, anticorps PCLP-1, anticorps PCB, anticorps AW121214, anticorps Ly102, anticorps Pclp1, anticorps podocalyxin, anticorps MEP21, anticorps PODXL, anticorps Gp135, anticorps PCLP1, anticorps cPCLP1, anticorps podxl, anticorps fc18d02, anticorps wu:fc18d02, anticorps Pc, anticorps Pcb, anticorps Podxl, anticorps podocalyxin like, anticorps pyruvate carboxylase, anticorps podocalyxin-like, anticorps PODXL, anticorps PC, anticorps Podxl, anticorps podxl, anticorps Pcx
- Sujet
- PODXL is a member of the sialomucin protein family. PODXL was originally identified as an important component of glomerular podocytes. Podocytes are highly differentiated epithelial cells with interdigitating foot processes covering the outer aspect of the glomerular basement membrane. Other biological activities of the protein include: binding in a membrane protein complex with Na+/H+ exchanger regulatory factor to intracellular cytoskeletal elements, playing a role in hematopoetic cell differentiation, and being expressed in vascular endothelium cells and binding to L-selectin.
- Poids moléculaire
- 56 kDa (MW of target protein)
- Pathways
- Tube Formation
-