SLC39A10 anticorps
-
- Antigène Voir toutes SLC39A10 Anticorps
- SLC39A10 (Solute Carrier Family 39 (Zinc Transporter), Member 10 (SLC39A10))
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLC39A10 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- SLC39 A10 antibody was raised using a synthetic peptide corresponding to a region with amino acids LHRQHRGMTELEPSKFSKQAAENEKKYYIEKLFERYGENGRLSFFGLEKL
- Top Product
- Discover our top product SLC39A10 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC39A10 Blocking Peptide, catalog no. 33R-5026, is also available for use as a blocking control in assays to test for specificity of this SLC39A10 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 10 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SLC39A10 (Solute Carrier Family 39 (Zinc Transporter), Member 10 (SLC39A10))
- Autre désignation
- SLC39A10 (SLC39A10 Produits)
- Synonymes
- anticorps LZT-Hs2, anticorps 2900042E17Rik, anticorps 5430433I10, anticorps mKIAA1265, anticorps Slc39a10, anticorps Zip10, anticorps zgc:63552, anticorps DKFZp459C165, anticorps solute carrier family 39 member 10, anticorps solute carrier family 39 (zinc transporter), member 10, anticorps solute carrier family 39 (zinc transporter), member 4-like, anticorps SLC39A10, anticorps Slc39a10, anticorps Slc39a4l, anticorps slc39a10
- Sujet
- Zinc is an essential cofactor for hundreds of enzymes. It is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation. SLC39A10 belongs to a subfamily of proteins that show structural characteristics of zinc transporters.Zinc is an essential cofactor for hundreds of enzymes. It is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation.
- Poids moléculaire
- 94 kDa (MW of target protein)
-