G6PC anticorps (N-Term)

N° du produit ABIN634831

Détail du produit anti-G6PC anticorps

Antigène: G6PC (Glucose 6-Phosphatase, Catalytic (G6PC))

Épitope: N-Term

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp G6PC est non-conjugé

Application: Western Blotting (WB)

Specificité: G6 PC antibody was raised against the N terminal of G6 C

Purification: Affinity purified

Immunogène: G6 PC antibody was raised using the N terminal of G6 C corresponding to a region with amino acids NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

G6PC Blocking Peptide, catalog no. 33R-6784, is also available for use as a blocking control in assays to test for specificity of this G6PC antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of G0 C antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur G6PC

Antigène: G6PC (Glucose 6-Phosphatase, Catalytic (G6PC))

Autre désignation: G6PC (G6PC Produits)

Synonymes: anticorps AW107337, anticorps G6Pase, anticorps G6pt, anticorps Glc-6-Pase, anticorps G6PC1, anticorps G6PT, anticorps GSD1, anticorps GSD1a, anticorps G-6-Pase, anticorps glucose-6-phosphatase, catalytic, anticorps glucose-6-phosphatase catalytic subunit, anticorps glucose-6-phosphatase, catalytic subunit, anticorps G6pc, anticorps G6PC

Sujet: G6PC hydrolyzes glucose-6-phosphate to glucose in the endoplasmic reticulum. It forms with the glucose-6-phosphate transporter (SLC37A4/G6PT) the complex responsible for glucose production through glycogenolysis and gluconeogenesis. Hence, it is the key enzyme in homeostatic regulation of blood glucose levels.

Poids moléculaire: 40 kDa (MW of target protein)

Pathways: Carbohydrate Homeostasis, Cellular Glucan Metabolic Process