Seladin 1 anticorps (N-Term)
-
- Antigène Voir toutes Seladin 1 (DHCR24) Anticorps
- Seladin 1 (DHCR24) (24-Dehydrocholesterol Reductase (DHCR24))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Seladin 1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- DHCR24 antibody was raised against the N terminal of DHCR24
- Purification
- Affinity purified
- Immunogène
- DHCR24 antibody was raised using the N terminal of DHCR24 corresponding to a region with amino acids FLLPLSLIFDIYYYVRAWVVFKLSSAPRLHEQRVRDIQKQVREWKEQGSK
- Top Product
- Discover our top product DHCR24 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
DHCR24 Blocking Peptide, catalog no. 33R-2970, is also available for use as a blocking control in assays to test for specificity of this DHCR24 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHCR24 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Seladin 1 (DHCR24) (24-Dehydrocholesterol Reductase (DHCR24))
- Autre désignation
- DHCR24 (DHCR24 Produits)
- Synonymes
- anticorps MGC82737, anticorps zgc:101638, anticorps DCE, anticorps Nbla03646, anticorps SELADIN1, anticorps seladin-1, anticorps 2310076D10Rik, anticorps 5830417J06Rik, anticorps mKIAA0018, anticorps 24-dehydrocholesterol reductase, anticorps 24-dehydrocholesterol reductase S homeolog, anticorps delta(24)-sterol reductase, anticorps DHCR24, anticorps dhcr24.S, anticorps dhcr24, anticorps LOC5575872, anticorps CpipJ_CPIJ000670, anticorps Dhcr24
- Sujet
- DHCR24 is a flavin adenine dinucleotide (FAD)-dependent oxidoreductase which catalyzes the reduction of the delta-24 double bond of sterol intermediates during cholesterol biosynthesis. The protein contains a leader sequence that directs it to the endoplasmic reticulum membrane. Missense mutations in this gene have been associated with desmosterolosis. Also, reduced expression of the gene occurs in the temporal cortex of Alzheimer disease patients and overexpression has been observed in adrenal gland cancer cells.
- Poids moléculaire
- 58 kDa (MW of target protein)
-