Arylsulfatase H anticorps (Middle Region)
-
- Antigène Voir toutes Arylsulfatase H (ARSH) Anticorps
- Arylsulfatase H (ARSH)
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Arylsulfatase H est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ARSH antibody was raised against the middle region of ARSH
- Purification
- Affinity purified
- Immunogène
- ARSH antibody was raised using the middle region of ARSH corresponding to a region with amino acids FIERYKREPFLLFFSFLHVHTPLISKKKFVGRSKYGRYGDNVEEMDWMVG
- Top Product
- Discover our top product ARSH Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ARSH Blocking Peptide, catalog no. 33R-2924, is also available for use as a blocking control in assays to test for specificity of this ARSH antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARSH antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Arylsulfatase H (ARSH)
- Autre désignation
- ARSH (ARSH Produits)
- Synonymes
- anticorps ARSH, anticorps LOC100232370, anticorps sulfatase, anticorps arylsulfatase family member H, anticorps arylsulfatase D, anticorps ARSH, anticorps LOC100232370, anticorps LOC100229427
- Sujet
- Sulfatases, such as ARSH, hydrolyze sulfate esters from sulfated steroids, carbohydrates, proteoglycans, and glycolipids. They are involved in hormone biosynthesis, modulation of cell signaling, and degradation of macromolecules.
- Poids moléculaire
- 63 kDa (MW of target protein)
-