KREMEN1 anticorps (N-Term)
-
- Antigène Voir toutes KREMEN1 Anticorps
- KREMEN1 (Kringle Containing Transmembrane Protein 1 (KREMEN1))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp KREMEN1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- KREMEN1 antibody was raised against the N terminal of KREMEN1
- Purification
- Affinity purified
- Immunogène
- KREMEN1 antibody was raised using the N terminal of KREMEN1 corresponding to a region with amino acids LKYPNGEGGLGEHNYCRNPDGDVSPWCYVAEHEDGVYWKYCEIPACQMPG
- Top Product
- Discover our top product KREMEN1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
KREMEN1 Blocking Peptide, catalog no. 33R-5114, is also available for use as a blocking control in assays to test for specificity of this KREMEN1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KREMEN1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- KREMEN1 (Kringle Containing Transmembrane Protein 1 (KREMEN1))
- Autre désignation
- KREMEN1 (KREMEN1 Produits)
- Synonymes
- anticorps KREMEN1, anticorps krm1, anticorps kremen, anticorps kremem1, anticorps KREMEN, anticorps KRM1, anticorps AV002070, anticorps Kremen, anticorps Krm1, anticorps si:ct737139.1, anticorps si:dkeyp-7c9.1, anticorps kringle containing transmembrane protein 1, anticorps kringle containing transmembrane protein 1 S homeolog, anticorps KREMEN1, anticorps kremen1, anticorps Kremen1, anticorps kremen1.S
- Sujet
- KREMEN1 is a high-affinity dickkopf homolog 1 (DKK1) transmembrane receptor that functionally cooperates with DKK1 to block wingless (WNT)/beta-catenin signaling. It is a component of a membrane complex that modulates canonical WNT signaling through lipoprotein receptor-related protein 6 (LRP6). It contains extracellular kringle, WSC, and CUB domains.
- Poids moléculaire
- 50 kDa (MW of target protein)
- Pathways
- Signalisation WNT
-