SLC43A2 anticorps (N-Term)

N° du produit ABIN634843

Détail du produit anti-SLC43A2 anticorps

Antigène: SLC43A2 (Solute Carrier Family 43, Member 2 (SLC43A2))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC43A2 est non-conjugé

Application: Western Blotting (WB)

Specificité: SLC43 A2 antibody was raised against the N terminal of SLC43 2

Purification: Affinity purified

Immunogène: SLC43 A2 antibody was raised using the N terminal of SLC43 2 corresponding to a region with amino acids TEPENVTNGTVGGTAEPGHEEVSWMNGWLSCQAQDEMLNLAFTVGSFLLS

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC43A2 Blocking Peptide, catalog no. 33R-9053, is also available for use as a blocking control in assays to test for specificity of this SLC43A2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC40 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC43A2

Antigène: SLC43A2 (Solute Carrier Family 43, Member 2 (SLC43A2))

Autre désignation: SLC43A2 (SLC43A2 Produits)

Synonymes: anticorps LAT4, anticorps lat4, anticorps MGC122003, anticorps 7630402D21Rik, anticorps BC042513, anticorps Lat4, anticorps RGD1305819, anticorps si:dkey-118k5.2, anticorps slc43a2, anticorps zgc:56271, anticorps DKFZp469D1521, anticorps cb941, anticorps wu:fb37c04, anticorps wu:fb38e03, anticorps wu:fb52a10, anticorps wu:fi32b04, anticorps xx:lithzf000079, anticorps zgc:103664, anticorps solute carrier family 43 member 2, anticorps solute carrier family 43 (amino acid system L transporter), member 2, anticorps solute carrier family 43, member 2, anticorps solute carrier family 43 (amino acid system L transporter), member 2a, anticorps solute carrier family 43 (amino acid system L transporter), member 2 L homeolog, anticorps solute carrier family 43 (amino acid system L transporter), member 2b, anticorps SLC43A2, anticorps slc43a2, anticorps Slc43a2, anticorps slc43a2a, anticorps slc43a2.L, anticorps slc43a2b

Sujet: SLC43A2 is a Sodium-, chloride, pH-independent high affinity transport of large neutral amino acids.

Poids moléculaire: 53 kDa (MW of target protein)