LMF2 anticorps (Middle Region)
-
- Antigène Voir toutes LMF2 Anticorps
- LMF2 (Lipase Maturation Factor 2 (LMF2))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp LMF2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- LMF2 antibody was raised against the middle region of LMF2
- Purification
- Affinity purified
- Immunogène
- LMF2 antibody was raised using the middle region of LMF2 corresponding to a region with amino acids YVEPGTHGRLWTGAHRLFGAVEHLQLANSYGLFRRMTGLGGRPEVVLEGS
- Top Product
- Discover our top product LMF2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
LMF2 Blocking Peptide, catalog no. 33R-10273, is also available for use as a blocking control in assays to test for specificity of this LMF2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LMF2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- LMF2 (Lipase Maturation Factor 2 (LMF2))
- Autre désignation
- LMF2 (LMF2 Produits)
- Synonymes
- anticorps TMEM112B, anticorps TMEM153, anticorps RGD1306274, anticorps Tmem112b, anticorps xlmf2, anticorps BC002942, anticorps zgc:194766, anticorps MGC145062, anticorps AI451006, anticorps Tmem153, anticorps im:7150505, anticorps im:7152257, anticorps lmf2, anticorps tmem112b, anticorps tmem153, anticorps lipase maturation factor 2, anticorps lipase maturation factor 2 L homeolog, anticorps lipase maturation factor 2a, anticorps lipase maturation factor 2b, anticorps LMF2, anticorps Lmf2, anticorps lmf2.L, anticorps lmf2a, anticorps lmf2, anticorps PITG_09785, anticorps Tsp_02101, anticorps lmf2b
- Sujet
- LMF2 belongs to the lipase maturation factor family. LMF2 is involved in the maturation of specific proteins in the endoplasmic reticulum. It may be required for maturation and transport of active lipoprotein lipase (LPL) through the secretory pathway.
- Poids moléculaire
- 77 kDa (MW of target protein)
-