SIL1 anticorps

N° du produit ABIN634845

Détail du produit anti-SIL1 anticorps

Antigène: SIL1 (Nucleotide Exchange Factor SIL1 (SIL1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SIL1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: SIL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLQQYRQVHLLPGLWEQGWCEITAHLLALPEHDAREKVLQTLGVLLTTCR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SIL1 Blocking Peptide, catalog no. 33R-4531, is also available for use as a blocking control in assays to test for specificity of this SIL1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SIL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SIL1

Antigène: SIL1 (Nucleotide Exchange Factor SIL1 (SIL1))

Autre désignation: SIL1 (SIL1 Produits)

Synonymes: anticorps 1810057E01Rik, anticorps AI042831, anticorps wz, anticorps BAP, anticorps MSS, anticorps ULG5, anticorps endoplasmic reticulum chaperone SIL1 homolog (S. cerevisiae), anticorps SIL1 nucleotide exchange factor L homeolog, anticorps SIL1 nucleotide exchange factor, anticorps Sil1, anticorps sil1.L, anticorps SIL1

Sujet: SIL1 is a resident endoplasmic reticulum (ER), N-linked glycoprotein with an N-terminal ER targeting sequence, 2 putative N-glycosylation sites, and a C-terminal ER retention signal. This protein functions as a nucleotide exchange factor for another unfolded protein response protein. Mutations in its gene have been associated with Marinesco-Sjogren syndrome.

Poids moléculaire: 49 kDa (MW of target protein)

Pathways: Unfolded Protein Response, SARS-CoV-2 Protein Interactome