MDM1 anticorps (N-Term)

N° du produit ABIN634846

Détail du produit anti-MDM1 anticorps

Antigène: MDM1 (Mdm1 Nuclear Protein (MDM1))

Épitope: N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MDM1 est non-conjugé

Application: Western Blotting (WB)

Specificité: MDM1 antibody was raised against the N terminal of MDM1

Purification: Affinity purified

Immunogène: MDM1 antibody was raised using the N terminal of MDM1 corresponding to a region with amino acids GLRSDQLGITKEPSFISKRRVPYHDPQISKSLEWNGAISESNVVASPEPE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MDM1 Blocking Peptide, catalog no. 33R-3420, is also available for use as a blocking control in assays to test for specificity of this MDM1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MDM1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MDM1

Antigène: MDM1 (Mdm1 Nuclear Protein (MDM1))

Autre désignation: MDM1 (MDM1 Produits)

Synonymes: anticorps si:ch211-266a5.6, anticorps Arrd2, anticorps Mdm-1, anticorps Mdm1 nuclear protein, anticorps Mdm1 nuclear protein homolog (mouse), anticorps transformed mouse 3T3 cell double minute 1, anticorps MDM1, anticorps Mdm1, anticorps mdm1

Sujet: MDM1 is a nuclear protein similar to the mouse double minute 1 protein. The mouse gene is located in double minute (DM) chromatin particles and is amplified in the mouse transformed 3T3 cell line, and the protein is able to bind to p53.

Poids moléculaire: 25 kDa (MW of target protein)