TMEM135 anticorps (N-Term)
-
- Antigène Voir toutes TMEM135 Anticorps
- TMEM135 (Transmembrane Protein 135 (TMEM135))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TMEM135 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- TMEM135 antibody was raised against the N terminal of TMEM135
- Purification
- Affinity purified
- Immunogène
- TMEM135 antibody was raised using the N terminal of TMEM135 corresponding to a region with amino acids SLKIYAPLYLIAAILRKRKLDYYLHKLLPEILQSASFLTANGALYMAFFC
- Top Product
- Discover our top product TMEM135 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
TMEM135 Blocking Peptide, catalog no. 33R-8601, is also available for use as a blocking control in assays to test for specificity of this TMEM135 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM135 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TMEM135 (Transmembrane Protein 135 (TMEM135))
- Autre désignation
- TMEM135 (TMEM135 Produits)
- Synonymes
- anticorps im:6901522, anticorps zgc:162425, anticorps PMP52, anticorps 2810439K08Rik, anticorps AW319712, anticorps RGD1309948, anticorps transmembrane protein 135, anticorps transmembrane protein 135 L homeolog, anticorps TMEM135, anticorps tmem135, anticorps CpipJ_CPIJ008774, anticorps tmem135.L, anticorps Tmem135
- Sujet
- TMEM135 protein is part of a conserved genetic network involved in fat storage and longevity regulation.
- Poids moléculaire
- 52 kDa (MW of target protein)
-