TMEM135 anticorps (N-Term)

N° du produit ABIN634847

Détail du produit anti-TMEM135 anticorps

Antigène: TMEM135 (Transmembrane Protein 135 (TMEM135))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMEM135 est non-conjugé

Application: Western Blotting (WB)

Specificité: TMEM135 antibody was raised against the N terminal of TMEM135

Purification: Affinity purified

Immunogène: TMEM135 antibody was raised using the N terminal of TMEM135 corresponding to a region with amino acids SLKIYAPLYLIAAILRKRKLDYYLHKLLPEILQSASFLTANGALYMAFFC

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMEM135 Blocking Peptide, catalog no. 33R-8601, is also available for use as a blocking control in assays to test for specificity of this TMEM135 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM135 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMEM135

Antigène: TMEM135 (Transmembrane Protein 135 (TMEM135))

Autre désignation: TMEM135 (TMEM135 Produits)

Synonymes: anticorps im:6901522, anticorps zgc:162425, anticorps PMP52, anticorps 2810439K08Rik, anticorps AW319712, anticorps RGD1309948, anticorps transmembrane protein 135, anticorps transmembrane protein 135 L homeolog, anticorps TMEM135, anticorps tmem135, anticorps CpipJ_CPIJ008774, anticorps tmem135.L, anticorps Tmem135

Sujet: TMEM135 protein is part of a conserved genetic network involved in fat storage and longevity regulation.

Poids moléculaire: 52 kDa (MW of target protein)