PDE3A anticorps (N-Term)

N° du produit ABIN634852

Détail du produit anti-PDE3A anticorps

Antigène: PDE3A (phosphodiesterase 3A, cGMP-Inhibited (PDE3A))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PDE3A est non-conjugé

Application: Western Blotting (WB)

Specificité: PDE3 A antibody was raised against the N terminal of PDE3

Purification: Affinity purified

Immunogène: PDE3 A antibody was raised using the N terminal of PDE3 corresponding to a region with amino acids LLADPSLPPNVCTSLRAVSNLLSTQLTFQAIHKPRVNPVTSLSENYTCSD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PDE3A Blocking Peptide, catalog no. 33R-5115, is also available for use as a blocking control in assays to test for specificity of this PDE3A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDE0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PDE3A

Antigène: PDE3A (phosphodiesterase 3A, cGMP-Inhibited (PDE3A))

Autre désignation: PDE3A (PDE3A Produits)

Synonymes: anticorps PDE3A, anticorps Pde3a, anticorps si:dkey-48h7.2, anticorps A930022O17Rik, anticorps C87899, anticorps RNPDE3A, anticorps CGI-PDE, anticorps CGI-PDE A, anticorps CGI-PDE-A, anticorps phosphodiesterase 3A, anticorps phosphodiesterase 3A, cGMP-inhibited, anticorps cGMP-inhibited 3',5'-cyclic phosphodiesterase A, anticorps phosphodiesterase 3A, cGMP inhibited, anticorps PDE3A, anticorps Pde3a, anticorps LOC100540515, anticorps pde3a

Sujet: PDE3A belongs to the cyclic nucleotide phosphodiesterase family. It hydrolyzes both cyclic AMP (cAMP) and cyclic GMP (cGMP).

Poids moléculaire: 125 kDa (MW of target protein)

Pathways: cAMP Metabolic Process