SLC23A2 anticorps

N° du produit ABIN634854

Détail du produit anti-SLC23A2 anticorps

Antigène: SLC23A2 (Solute Carrier Family 23 (Nucleobase Transporters), Member 2 (SLC23A2))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC23A2 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: SLC23 A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VALIGLSGFQAAGERAGKHWGIAMLTIFLVLLFSQYARNVKFPLPIYKSK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC23A2 Blocking Peptide, catalog no. 33R-9424, is also available for use as a blocking control in assays to test for specificity of this SLC23A2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC23A2

Antigène: SLC23A2 (Solute Carrier Family 23 (Nucleobase Transporters), Member 2 (SLC23A2))

Autre désignation: SLC23A2 (SLC23A2 Produits)

Synonymes: anticorps NBTL1, anticorps SLC23A1, anticorps SVCT2, anticorps YSPL2, anticorps SLC23A2, anticorps AI844736, anticorps Slc23a1, anticorps YSPL3, anticorps mKIAA0238, anticorps solute carrier family 23 member 2, anticorps solute carrier family 23 (nucleobase transporters), member 2, anticorps SLC23A2, anticorps Slc23a2

Sujet: The absorption of vitamin C into the body and its distribution to organs requires two sodium-dependent vitamin C transporters. This gene encodes one of the two required transporters and the encoded protein accounts for tissue-specific uptake of vitamin C. Previously, this gene had an official symbol of SLC23A1.

Poids moléculaire: 70 kDa (MW of target protein)

Pathways: Skeletal Muscle Fiber Development