Glycoprotein anticorps

N° du produit ABIN634855

Détail du produit

Antigène: Glycoprotein

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Inconjugué

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: Glycoprotein antibody was raised using a synthetic peptide corresponding to a region with amino acids DGENGTGQSHHNVFPDGKPFPHHPGWRRWNFIYVFHTLGQYFQKLGRCSV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Glycoprotein Blocking Peptide, catalog no. 33R-1947, is also available for use as a blocking control in assays to test for specificity of this Glycoprotein antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPNMB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détail du antigène

Antigène: Glycoprotein

Synonymes: anticorps glycoprotein, anticorps Glycoprotein, anticorps transmembrane glycoprotein G, anticorps G, anticorps RVFV_sM_gp1, anticorps RABVgp4

Classe de substances: Viral Protein

Sujet: GPNMB is a type I transmembrane glycoprotein which shows homology to the pMEL17 precursor, a melanocyte-specific protein. GPNMB shows expression in the lowly metastatic human melanoma cell lines and xenografts.

Poids moléculaire: 62 kDa (MW of target protein)