RNF170 anticorps (C-Term)

N° du produit ABIN634858

Détail du produit anti-RNF170 anticorps

Antigène: RNF170 (Ring Finger Protein 170 (RNF170))

Épitope: C-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RNF170 est non-conjugé

Application: Western Blotting (WB)

Specificité: RNF170 antibody was raised against the C terminal of RNF170

Purification: Affinity purified

Immunogène: RNF170 antibody was raised using the C terminal of RNF170 corresponding to a region with amino acids FYLISPLDFVPEALFGILGFLDDFFVIFLLLIYISIMYREVITQRLTR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RNF170 Blocking Peptide, catalog no. 33R-3138, is also available for use as a blocking control in assays to test for specificity of this RNF170 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF170 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RNF170

Antigène: RNF170 (Ring Finger Protein 170 (RNF170))

Autre désignation: RNF170 (RNF170 Produits)

Synonymes: anticorps SNAX1, anticorps 6720407G21Rik, anticorps AI481227, anticorps ring finger protein 170, anticorps ring finger protein 170 L homeolog, anticorps microRNA 4469, anticorps Rnf170, anticorps RNF170, anticorps rnf170.L, anticorps MIR4469

Sujet: RNF170 is a multi-pass membrane proteinPotential. It contains 1 RING-type zinc finger. The exact function of RNF170 remains unknown.

Poids moléculaire: 30 kDa (MW of target protein)