AREL1 anticorps (Middle Region)

N° du produit ABIN634861

Détail du produit anti-AREL1 anticorps

Antigène: AREL1 (Apoptosis Resistant E3 Ubiquitin Protein Ligase 1 (AREL1))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp AREL1 est non-conjugé

Application: Western Blotting (WB)

Specificité: KIAA0317 antibody was raised against the middle region of KIAA0317

Purification: Affinity purified

Immunogène: KIAA0317 antibody was raised using the middle region of KIAA0317 corresponding to a region with amino acids VRARFTRSFLAQIIGLRMHYKYFETDDPEFYKSKVCFILNNDMSEMELVF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KIAA0317 Blocking Peptide, catalog no. 33R-9768, is also available for use as a blocking control in assays to test for specificity of this KIAA0317 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIAA0317 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur AREL1

Antigène: AREL1 (Apoptosis Resistant E3 Ubiquitin Protein Ligase 1 (AREL1))

Autre désignation: KIAA0317 (AREL1 Produits)

Synonymes: anticorps KIAA0317, anticorps apoptosis resistant E3 ubiquitin protein ligase 1, anticorps AREL1

Sujet: KIAA0317 contains 1 filamin repeat and 1 HECT (E6AP-type E3 ubiquitin-protein ligase) domain. The exact function of KIAA0317 remains unknown.

Poids moléculaire: 94 kDa (MW of target protein)