GGCX anticorps (Middle Region)
-
- Antigène Voir toutes GGCX Anticorps
- GGCX (gamma-Glutamyl Carboxylase (GGCX))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp GGCX est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- GGCX antibody was raised against the middle region of GGCX
- Purification
- Affinity purified
- Immunogène
- GGCX antibody was raised using the middle region of GGCX corresponding to a region with amino acids FLLRKLYVFRRSFLMTCISLRNLILGRPSLEQLAQEVTYANLRPFEAVGE
- Top Product
- Discover our top product GGCX Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GGCX Blocking Peptide, catalog no. 33R-2973, is also available for use as a blocking control in assays to test for specificity of this GGCX antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GGCX antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- GGCX (gamma-Glutamyl Carboxylase (GGCX))
- Autre désignation
- GGCX (GGCX Produits)
- Synonymes
- anticorps GGCX, anticorps cb751, anticorps si:ch1073-230p18.3, anticorps zgc:158736, anticorps ggcx, anticorps GGC, anticorps vkcfd1, anticorps CG13927, anticorps DgammaC, anticorps Dmel\\CG13927, anticorps dGC, anticorps dgammaC, anticorps gammaC, anticorps VKCFD1, anticorps gamma-glutamyl carboxylase, anticorps gamma-glutamyl carboxylase L homeolog, anticorps GGCX, anticorps ggcx, anticorps GC, anticorps sce5891, anticorps ggcx.L, anticorps Ggcx
- Sujet
- GGCX is an enzyme which catalyzes the posttranslational modification of vitamin K-dependent protein. Many of these vitamin K-dependent proteins are involved in coagulation so the function of the encoded enzyme is essential for hemostasis. Mutations in this gene are associated with vitamin K-dependent coagulation defect and PXE-like disorder with multiple coagulation factor deficiency.
- Poids moléculaire
- 87 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interactome
-