Thymopoietin anticorps (N-Term)
-
- Antigène Voir toutes Thymopoietin (TMPO) Anticorps
- Thymopoietin (TMPO)
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Thymopoietin est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Thymopoietin antibody was raised against the N terminal of TMPO
- Purification
- Affinity purified
- Immunogène
- Thymopoietin antibody was raised using the N terminal of TMPO corresponding to a region with amino acids MPEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNR
- Top Product
- Discover our top product TMPO Anticorps primaire
-
anti-Thymopoietin (TMPO) (AA 1-410) antibody
TMPO Reactivité: Humain WB, IHC, IF Hôte: Lapin Polyclonal unconjugated
anti-Thymopoietin (TMPO) (AA 1-50) antibodyTMPO Reactivité: Humain WB, ELISA Hôte: Lapin Polyclonal unconjugated
anti-Thymopoietin (TMPO) (AA 1-243) antibodyTMPO Reactivité: Humain WB, IHC, ICC Hôte: Lapin Polyclonal unconjugated
anti-Thymopoietin (TMPO) (AA 34-156) antibodyTMPO Reactivité: Humain, Souris, Rat, Chien WB, IF Hôte: Souris Monoclonal 27-LAP2 unconjugated
anti-Thymopoietin (TMPO) (AA 1-454) antibodyTMPO Reactivité: Humain WB Hôte: Souris Polyclonal unconjugated
anti-Thymopoietin (TMPO) antibodyTMPO Reactivité: Humain, Souris, Rat WB, IHC, IF, IC Hôte: Lapin Polyclonal unconjugated
anti-Thymopoietin (TMPO) (AA 243-269) antibodyTMPO Reactivité: Humain WB Hôte: Lapin Polyclonal RB39917 unconjugated
anti-Thymopoietin (TMPO) (AA 650-750) antibodyTMPO Reactivité: Humain WB, IF, ICC, IP Hôte: Souris Monoclonal 3A3 unconjugated
anti-Thymopoietin (TMPO) (AA 143-192) antibodyTMPO Reactivité: Humain, Souris, Boeuf (Vache), Chien, Cobaye, Lapin, Cheval, Porc, Singe WB Hôte: Lapin Polyclonal unconjugated
anti-Thymopoietin (TMPO) (N-Term) antibodyTMPO Reactivité: Humain, Souris, Rat, Boeuf (Vache), Chien, Cobaye, Lapin, Cheval, Porc, Poulet, Xenopus laevis WB Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Thymopoietin Blocking Peptide, catalog no. 33R-6275, is also available for use as a blocking control in assays to test for specificity of this Thymopoietin antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMPO antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Thymopoietin (TMPO)
- Autre désignation
- Thymopoietin (TMPO Produits)
- Synonymes
- anticorps LAP2, anticorps CMD1T, anticorps LEMD4, anticorps PRO0868, anticorps TP, anticorps lap2, anticorps LAP2beta, anticorps 5630400D24Rik, anticorps AI195756, anticorps AI606875, anticorps AW214352, anticorps AW547477, anticorps tmpo, anticorps wu:fc26f12, anticorps wu:fd21f02, anticorps wu:fi29h05, anticorps thymopoietin, anticorps thymopoietin S homeolog, anticorps thymopoietin a, anticorps TMPO, anticorps Tmpo, anticorps tmpo.S, anticorps tmpoa
- Sujet
- TMPO may be involved in the structural organization of the nucleus and in the post-mitotic nuclear assembly. It plays an important role, together with LMNA, in the nuclear anchorage of RB1.
- Poids moléculaire
- 39 kDa (MW of target protein)
-
