DNASE1 anticorps (N-Term)

N° du produit ABIN634872

Détail du produit anti-DNASE1 anticorps

Antigène: DNASE1 (Deoxyribonuclease I (DNASE1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DNASE1 est non-conjugé

Application: Western Blotting (WB)

Specificité: DNASE1 antibody was raised against the N terminal of DNASE1

Purification: Affinity purified

Immunogène: DNASE1 antibody was raised using the N terminal of DNASE1 corresponding to a region with amino acids GKLLDNLNQDAPDTYHYVVSEPLGRNSYKERYLFVYRPDQVSAVDSYYYD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DNASE1 Blocking Peptide, catalog no. 33R-3371, is also available for use as a blocking control in assays to test for specificity of this DNASE1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DNASE1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DNASE1

Antigène: DNASE1 (Deoxyribonuclease I (DNASE1))

Autre désignation: DNASE1 (DNASE1 Produits)

Synonymes: anticorps LOC397802, anticorps DNL1, anticorps DRNI, anticorps AI788650, anticorps DNaseI, anticorps Dnl1, anticorps dnase1-A, anticorps zgc:92440, anticorps DNase I, anticorps deoxyribonuclease 1, anticorps deoxyribonuclease I, anticorps deoxyribonuclease I L homeolog, anticorps Deoxyribonuclease I, anticorps endA, anticorps LOC397802, anticorps DNASE1, anticorps Dnase1, anticorps dnase1.L, anticorps dnase1, anticorps CpipJ_CPIJ011184, anticorps CpipJ_CPIJ011185, anticorps CpipJ_CPIJ011186, anticorps CpipJ_CPIJ011187, anticorps CpipJ_CPIJ011190, anticorps CpipJ_CPIJ017803, anticorps Desal_1409, anticorps MPET_RS05255, anticorps METEV_RS02275, anticorps Plabr_0631

Sujet: This gene encodes a member of the DNase family. This protein is stored in the zymogen granules of the nuclear envelope and functions by cleaving DNA in an endonucleolytic manner. At least six autosomal codominant alleles have been characterized.

Poids moléculaire: 29 kDa (MW of target protein)