ENTPD7 anticorps (C-Term)

N° du produit ABIN634874

Détail du produit anti-ENTPD7 anticorps

Antigène: ENTPD7 (Ectonucleoside Triphosphate diphosphohydrolase 7 (ENTPD7))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ENTPD7 est non-conjugé

Application: Western Blotting (WB)

Specificité: ENTPD7 antibody was raised against the C terminal of ENTPD7

Purification: Affinity purified

Immunogène: ENTPD7 antibody was raised using the C terminal of ENTPD7 corresponding to a region with amino acids EHRLKYQCFKSAWMYQVLHEGFHFPYDYPNLRTAQLVYDREVQWTLGAIL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ENTPD7 Blocking Peptide, catalog no. 33R-2459, is also available for use as a blocking control in assays to test for specificity of this ENTPD7 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ENTPD7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ENTPD7

Antigène: ENTPD7 (Ectonucleoside Triphosphate diphosphohydrolase 7 (ENTPD7))

Autre désignation: ENTPD7 (ENTPD7 Produits)

Synonymes: anticorps LALP1, anticorps NTPDase7, anticorps RP11-483F11.1, anticorps 1810012B13Rik, anticorps 1810020C02Rik, anticorps 2810003F23Rik, anticorps Lysal2, anticorps ectonucleoside triphosphate diphosphohydrolase 7, anticorps ectonucleoside triphosphate diphosphohydrolase 7 L homeolog, anticorps ENTPD7, anticorps entpd7, anticorps entpd7.L, anticorps Entpd7

Sujet: ENTPD7 is a multi-pass membrane protein.It belongs to the GDA1/CD39 NTPase family. It preferentially hydrolyzes nucleoside 5'-triphosphates. The order of activity with respect to possible substrates is UTP > GTP > CTP.

Poids moléculaire: 69 kDa (MW of target protein)