GPR75 anticorps (Middle Region)
-
- Antigène Voir toutes GPR75 Anticorps
- GPR75 (G Protein-Coupled Receptor 75 (GPR75))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp GPR75 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- GPR75 antibody was raised against the middle region of GPR75
- Purification
- Affinity purified
- Immunogène
- GPR75 antibody was raised using the middle region of GPR75 corresponding to a region with amino acids GQSSSTPINTRIEPYYSIYNSSPSQEESSPCNLQPVNSFGFANSYIAMHY
- Top Product
- Discover our top product GPR75 Anticorps primaire
-
anti-G Protein-Coupled Receptor 75 (GPR75) (AA 372-540) antibody
GPR75 Reactivité: Humain WB, ELISA, IHC, IF Hôte: Lapin Polyclonal unconjugated
anti-G Protein-Coupled Receptor 75 (GPR75) (Extracellular Domain) antibodyGPR75 Reactivité: Humain, Cheval, Singe, Roussette (Chauve-souris), Xenopus laevis IHC, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-G Protein-Coupled Receptor 75 (GPR75) (C-Term) antibodyGPR75 Reactivité: Humain, Cheval, Boeuf (Vache), Porc, Lapin, Singe, Roussette (Chauve-souris) IHC, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-G Protein-Coupled Receptor 75 (GPR75) (Cytoplasmic Domain) antibodyGPR75 Reactivité: Humain, Cheval, Boeuf (Vache), Porc IHC, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-G Protein-Coupled Receptor 75 (GPR75) (C-Term) antibodyGPR75 Reactivité: Humain, Rat, Cheval, Boeuf (Vache), Porc, Lapin, Singe, Hamster, Roussette (Chauve-souris), Xenopus laevis, Poulet IHC, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-G Protein-Coupled Receptor 75 (GPR75) (C-Term) antibodyGPR75 Reactivité: Humain, Cheval, Boeuf (Vache), Porc, Lapin, Singe, Hamster IHC, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-G Protein-Coupled Receptor 75 (GPR75) (AA 270-319) antibodyGPR75 Reactivité: Humain, Lapin, Singe, Hamster WB Hôte: Lapin Polyclonal unconjugated
anti-G Protein-Coupled Receptor 75 (GPR75) (Middle Region) antibodyGPR75 Reactivité: Humain, Souris, Rat, Cheval, Boeuf (Vache), Porc, Lapin, Poisson zèbre (Danio rerio) WB Hôte: Lapin Polyclonal unconjugated
anti-G Protein-Coupled Receptor 75 (GPR75) (C-Term) antibodyGPR75 Reactivité: Humain WB, ELISA, IF Hôte: Lapin Polyclonal unconjugated
anti-G Protein-Coupled Receptor 75 (GPR75) (C-Term) antibodyGPR75 Reactivité: Humain, Souris WB, ELISA, IF Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GPR75 Blocking Peptide, catalog no. 33R-3513, is also available for use as a blocking control in assays to test for specificity of this GPR75 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPR75 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- GPR75 (G Protein-Coupled Receptor 75 (GPR75))
- Autre désignation
- GPR75 (GPR75 Produits)
- Synonymes
- anticorps GPR75, anticorps GPRchr2, anticorps WI31133, anticorps G protein-coupled receptor 75, anticorps G protein-coupled receptor 75 S homeolog, anticorps GPR75, anticorps gpr75, anticorps Gpr75, anticorps gpr75.S
- Sujet
- GPR75 is a member of the G protein-coupled receptor family. GPRs are cell surface receptors that activate guanine-nucleotide binding proteins upon the binding of a ligand.GPR75 is a member of the G protein-coupled receptor family. GPRs are cell surface receptors that activate guanine-nucleotide binding proteins upon the binding of a ligand.
- Poids moléculaire
- 59 kDa (MW of target protein)
-
