LEMD2 anticorps (Middle Region)

N° du produit ABIN634879

Détail du produit anti-LEMD2 anticorps

Antigène: LEMD2 (LEM Domain Containing 2 (LEMD2))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LEMD2 est non-conjugé

Application: Western Blotting (WB)

Specificité: LEMD2 antibody was raised against the middle region of LEMD2

Purification: Affinity purified

Immunogène: LEMD2 antibody was raised using the middle region of LEMD2 corresponding to a region with amino acids QDMERYPYVGILHVRDSLIPPQSRRRMKRVWDRAVEFLASNESRIQTESH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LEMD2 Blocking Peptide, catalog no. 33R-7506, is also available for use as a blocking control in assays to test for specificity of this LEMD2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LEMD2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LEMD2

Antigène: LEMD2 (LEM Domain Containing 2 (LEMD2))

Autre désignation: LEMD2 (LEMD2 Produits)

Synonymes: anticorps NET25, anticorps dJ482C21.1, anticorps BC026588, anticorps Lem2, anticorps LEM domain containing 2, anticorps LEMD2, anticorps Lemd2

Sujet: LEMD2 is involved in nuclear structure organization.

Poids moléculaire: 57 kDa (MW of target protein)