SLC26A1 anticorps

N° du produit ABIN634881

Détail du produit anti-SLC26A1 anticorps

Antigène: SLC26A1 (Solute Carrier Family 26 (Sulfate Transporter), Member 1 (SLC26A1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC26A1 est non-conjugé

Application: Immunohistochemistry (IHC), Western Blotting (WB)

Purification: Affinity purified

Immunogène: SLC26 A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LYSLTGLDAGCMAARRKEGGSETGVGEGGPAQGEDLGPVSTRAALVPAAA

Information d'application

Indications d'application: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC26A1 Blocking Peptide, catalog no. 33R-5575, is also available for use as a blocking control in assays to test for specificity of this SLC26A1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC26A1

Antigène: SLC26A1 (Solute Carrier Family 26 (Sulfate Transporter), Member 1 (SLC26A1))

Autre désignation: SLC26A1 (SLC26A1 Produits)

Synonymes: anticorps edm4, anticorps sat1, anticorps sat-1, anticorps MGC86347, anticorps SLC26A1, anticorps sb:cb565, anticorps wu:fe23c03, anticorps zgc:158435, anticorps EDM4, anticorps SAT-1, anticorps SAT1, anticorps Sat1, anticorps solute carrier family 26 (anion exchanger), member 1 L homeolog, anticorps solute carrier family 26 member 1, anticorps solute carrier family 26 (anion exchanger), member 1, anticorps solute carrier family 26 (sulfate transporter), member 1, anticorps slc26a1.L, anticorps SLC26A1, anticorps slc26a1, anticorps Slc26a1

Sujet: SLC26A1 is a member of sulfate/anion transporter family. Family members are well conserved in their protein (aa length among species) structures, but have markedly different tissue expression patterns. Its gene is primarily expressed in the liver, pancreas, and brain.

Poids moléculaire: 77 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process, Ribonucleoside Biosynthetic Process, Dicarboxylic Acid Transport