GRAMD2 anticorps (Middle Region)
-
- Antigène Tous les produits GRAMD2
- GRAMD2 (GRAM Domain Containing 2 (GRAMD2))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp GRAMD2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- GRAMD2 antibody was raised against the middle region of GRAMD2
- Purification
- Affinity purified
- Immunogène
- GRAMD2 antibody was raised using the middle region of GRAMD2 corresponding to a region with amino acids LPNGLAITTNTSQKYIFVSLLSRDSVYDLLRRVCTHLQPSSKKSLSVREF
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GRAMD2 Blocking Peptide, catalog no. 33R-5276, is also available for use as a blocking control in assays to test for specificity of this GRAMD2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GRAMD2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- GRAMD2 (GRAM Domain Containing 2 (GRAMD2))
- Autre désignation
- GRAMD2 (GRAMD2 Produits)
- Synonymes
- anticorps BC064463, anticorps RGD1564007, anticorps Gramd2, anticorps GRAM domain containing 2, anticorps GRAM domain containing 2A, anticorps Gramd2, anticorps GRAMD2A, anticorps Gramd2a
- Sujet
- The function of GRAMD2 protein has not been widely studied, and is yet to be fully elucidated.
- Poids moléculaire
- 40 kDa (MW of target protein)
-