GRAMD2 anticorps (Middle Region)

N° du produit ABIN634882

Détail du produit anti-GRAMD2 anticorps

Antigène: GRAMD2 (GRAM Domain Containing 2 (GRAMD2))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GRAMD2 est non-conjugé

Application: Western Blotting (WB)

Specificité: GRAMD2 antibody was raised against the middle region of GRAMD2

Purification: Affinity purified

Immunogène: GRAMD2 antibody was raised using the middle region of GRAMD2 corresponding to a region with amino acids LPNGLAITTNTSQKYIFVSLLSRDSVYDLLRRVCTHLQPSSKKSLSVREF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GRAMD2 Blocking Peptide, catalog no. 33R-5276, is also available for use as a blocking control in assays to test for specificity of this GRAMD2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GRAMD2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GRAMD2

Antigène: GRAMD2 (GRAM Domain Containing 2 (GRAMD2))

Autre désignation: GRAMD2 (GRAMD2 Produits)

Synonymes: anticorps BC064463, anticorps RGD1564007, anticorps Gramd2, anticorps GRAM domain containing 2, anticorps GRAM domain containing 2A, anticorps Gramd2, anticorps GRAMD2A, anticorps Gramd2a

Sujet: The function of GRAMD2 protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 40 kDa (MW of target protein)