Plexin A2 anticorps (N-Term)

N° du produit ABIN634887

Détail du produit anti-Plexin A2 anticorps

Antigène: Plexin A2 (Plxna2)

Épitope: N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Plexin A2 est non-conjugé

Application: Western Blotting (WB)

Specificité: Plexin A2 antibody was raised against the N terminal of PLXNA2

Purification: Affinity purified

Immunogène: Plexin A2 antibody was raised using the N terminal of PLXNA2 corresponding to a region with amino acids SVASYVYNGYSVVFVGTKSGKLKKIRADGPPHGGVQYEMVSVLKDGSPIL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Plexin A2 Blocking Peptide, catalog no. 33R-8901, is also available for use as a blocking control in assays to test for specificity of this Plexin A2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLXNA2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Plexin A2

Antigène: Plexin A2 (Plxna2)

Autre désignation: Plexin A2 (Plxna2 Produits)

Synonymes: anticorps oct, anticorps plxn2, anticorps OCT, anticorps PLXN2, anticorps 2810428A13Rik, anticorps AA589422, anticorps AW457381, anticorps Plxn2, anticorps mKIAA0463, anticorps plexin A2, anticorps plexin-A2, anticorps PLXNA2, anticorps plxna2, anticorps LOC100078346, anticorps Plxna2

Sujet: PLXNA2 is a member of the plexin-A family of semaphorin co-receptors. Semaphorins are a large family of secreted or membrane-bound proteins that mediate repulsive effects on axon pathfinding during nervous system development. A subset of semaphorins are recognised by plexin-A/neuropilin transmembrane receptor complexes, triggering a cellular signal transduction cascade that leads to axon repulsion.

Poids moléculaire: 211 kDa (MW of target protein)