CLN6 anticorps (C-Term)

N° du produit ABIN634889

Détail du produit anti-CLN6 anticorps

Antigène: CLN6 (Ceroid-Lipofuscinosis, Neuronal 6, Late Infantile, Variant (CLN6))

Épitope: C-Term

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CLN6 est non-conjugé

Application: Western Blotting (WB)

Specificité: CLN6 antibody was raised against the C terminal of CLN6

Purification: Affinity purified

Immunogène: CLN6 antibody was raised using the C terminal of CLN6 corresponding to a region with amino acids RLFLDSNGLFLFSSFALTLLLVALWVAWLWNDPVLRKKYPGVIYVPEPWA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CLN6 Blocking Peptide, catalog no. 33R-8022, is also available for use as a blocking control in assays to test for specificity of this CLN6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLN6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CLN6

Antigène: CLN6 (Ceroid-Lipofuscinosis, Neuronal 6, Late Infantile, Variant (CLN6))

Autre désignation: CLN6 (CLN6 Produits)

Synonymes: anticorps 1810065L06Rik, anticorps AW743417, anticorps D9Bwg1455e, anticorps nclf, anticorps CLN4A, anticorps HsT18960, anticorps cln6, anticorps zgc:103565, anticorps ceroid-lipofuscinosis, neuronal 6, anticorps CLN6, transmembrane ER protein, anticorps CLN6, transmembrane ER protein S homeolog, anticorps ceroid-lipofuscinosis, neuronal 6, late infantile, variant, anticorps CLN6, transmembrane ER protein a, anticorps Cln6, anticorps CLN6, anticorps cln6.S, anticorps cln6a

Sujet: CLN6 is one of eight which have been associated with neuronal ceroid lipofuscinoses (NCL). Also referred to as Batten disease, NCL comprises a class of autosomal recessive, neurodegenerative disorders affecting children. The genes responsible likely CLN6 involved in the degradation of post-translationally modified proteins in lysosomes. The primary defect in NCL disorders is thought to be associated with lysosomal storage function.

Poids moléculaire: 36 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process