LAPTM4B anticorps (Middle Region)
-
- Antigène Voir toutes LAPTM4B Anticorps
- LAPTM4B (Lysosomal Protein Transmembrane 4 beta (LAPTM4B))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp LAPTM4B est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- LAPTM4 B antibody was raised against the middle region of LAPTM4
- Purification
- Affinity purified
- Immunogène
- LAPTM4 B antibody was raised using the middle region of LAPTM4 corresponding to a region with amino acids YPNSIQEYIRQLPPNFPYRDDVMSVNPTCLVLIILLFISIILTFKGYLIS
- Top Product
- Discover our top product LAPTM4B Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
LAPTM4B Blocking Peptide, catalog no. 33R-10204, is also available for use as a blocking control in assays to test for specificity of this LAPTM4B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LAPTM0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- LAPTM4B (Lysosomal Protein Transmembrane 4 beta (LAPTM4B))
- Autre désignation
- LAPTM4B (LAPTM4B Produits)
- Synonymes
- anticorps LAPTM4beta, anticorps LC27, anticorps C330023P13Rik, anticorps lysosomal protein transmembrane 4 beta, anticorps lysosomal-associated protein transmembrane 4B, anticorps LAPTM4B, anticorps Laptm4b
- Sujet
- LAPTM4B is a multi-pass membrane protein. It belongs to the LAPTM4/LAPTM5 transporter family. LAPTM4b has active role in disease progression of malignant cells and is involved in cell proliferation and multidrug resistance. The genetic polymorphism of LAPTM4B is a potential risk factor for the development of colon cancer and gastric cancer. The research results also indicated that LAPTM4B may be a clinically useful prognostic indicator for ovarian carcinoma and may play a role in human hepatocellular carcinoma.
- Poids moléculaire
- 35 kDa (MW of target protein)
-