LRRC52 anticorps (N-Term)

N° du produit ABIN634893

Détail du produit anti-LRRC52 anticorps

Antigène: LRRC52 (Leucine Rich Repeat Containing 52 (LRRC52))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LRRC52 est non-conjugé

Application: Western Blotting (WB)

Specificité: LRRC52 antibody was raised against the N terminal of LRRC52

Purification: Affinity purified

Immunogène: LRRC52 antibody was raised using the N terminal of LRRC52 corresponding to a region with amino acids QEVICTGKQLTEYPLDIPLNTRRLFLNENRITSLPAMHLGLLSDLVYLDC

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LRRC52 Blocking Peptide, catalog no. 33R-7542, is also available for use as a blocking control in assays to test for specificity of this LRRC52 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC52 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LRRC52

Antigène: LRRC52 (Leucine Rich Repeat Containing 52 (LRRC52))

Autre désignation: LRRC52 (LRRC52 Produits)

Synonymes: anticorps 4930413P14Rik, anticorps leucine rich repeat containing 52, anticorps LRRC52, anticorps Lrrc52

Sujet: The function of LRRC52 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 35 kDa (MW of target protein)