ST8SIA6 anticorps (Middle Region)

N° du produit ABIN634897

Détail du produit anti-ST8SIA6 anticorps

Antigène: ST8SIA6 (ST8 alpha-N-Acetyl-Neuraminide alpha-2,8-Sialyltransferase 6 (ST8SIA6))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ST8SIA6 est non-conjugé

Application: Western Blotting (WB)

Specificité: ST8 SIA6 antibody was raised against the middle region of ST8 IA6

Purification: Affinity purified

Immunogène: ST8 SIA6 antibody was raised using the middle region of ST8 IA6 corresponding to a region with amino acids LEESKARQKVLFFHPKYLKDLALFWRTKGVTAYRLSTGLMITSVAVELCK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ST8SIA6 Blocking Peptide, catalog no. 33R-4893, is also available for use as a blocking control in assays to test for specificity of this ST8SIA6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ST0 IA6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ST8SIA6

Antigène: ST8SIA6 (ST8 alpha-N-Acetyl-Neuraminide alpha-2,8-Sialyltransferase 6 (ST8SIA6))

Autre désignation: ST8SIA6 (ST8SIA6 Produits)

Synonymes: anticorps Siat8f, anticorps SIAT8F, anticorps siat8F, anticorps siat 8F, anticorps wu:fa12f08, anticorps wu:fb95c11, anticorps SIA8F, anticorps ST8SIA-VI, anticorps 1700007J08Rik, anticorps AI314453, anticorps AI875066, anticorps ST8SiaVI, anticorps ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 6, anticorps St8sia6, anticorps ST8SIA6, anticorps st8sia6, anticorps LOC592192

Sujet: Sialic acid is a key determinate of oligosaccharide structures involved in cell-cell communication, cell-substrate interaction, adhesion, and protein targeting.

Poids moléculaire: 45 kDa (MW of target protein)