SLC30A8 anticorps
-
- Antigène Voir toutes SLC30A8 Anticorps
- SLC30A8 (Solute Carrier Family 30 (Zinc Transporter), Member 8 (SLC30A8))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLC30A8 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- SLC30 A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids LLIDLTSFLLSLFSLWLSSKPPSKRLTFGWHRAEILGALLSILCIWVVTG
- Top Product
- Discover our top product SLC30A8 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC30A8 Blocking Peptide, catalog no. 33R-5148, is also available for use as a blocking control in assays to test for specificity of this SLC30A8 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 8 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SLC30A8 (Solute Carrier Family 30 (Zinc Transporter), Member 8 (SLC30A8))
- Autre désignation
- SLC30A8 (SLC30A8 Produits)
- Synonymes
- anticorps C820002P14Rik, anticorps ZnT-8, anticorps ZnT8, anticorps slc30a3, anticorps znt8, anticorps ZNT8, anticorps E130106K10Rik, anticorps Gm212, anticorps wu:fe49g03, anticorps RGD1305098, anticorps solute carrier family 30 member 8, anticorps solute carrier family 30 (zinc transporter), member 8, anticorps solute carrier family 30 (zinc transporter), member 8 L homeolog, anticorps solute carrier family 30, member 10, anticorps SLC30A8, anticorps Slc30a8, anticorps slc30a8.L, anticorps slc30a8, anticorps Slc30a10
- Sujet
- The protein encoded by this gene is a zinc efflux transporter involved in the accumulation of zinc in intracellular vesicles. This gene is expressed at a high level only in the pancreas, particularly in islets of Langerhans.
- Poids moléculaire
- 41 kDa (MW of target protein)
- Pathways
- Positive Regulation of Peptide Hormone Secretion, Hormone Transport, Carbohydrate Homeostasis, Transition Metal Ion Homeostasis
-