SLC43A1 anticorps (Middle Region)
-
- Antigène Voir toutes SLC43A1 Anticorps
- SLC43A1 (Solute Carrier Family 43, Member 1 (SLC43A1))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLC43A1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SLC43 A1 antibody was raised against the middle region of SLC43 1
- Purification
- Affinity purified
- Immunogène
- SLC43 A1 antibody was raised using the middle region of SLC43 1 corresponding to a region with amino acids AVNKMLEYLVTGGQEHETNEQQQKVAETVGFYSSVFGAMQLLCLLTCPLI
- Top Product
- Discover our top product SLC43A1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC43A1 Blocking Peptide, catalog no. 33R-1608, is also available for use as a blocking control in assays to test for specificity of this SLC43A1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC40 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SLC43A1 (Solute Carrier Family 43, Member 1 (SLC43A1))
- Autre désignation
- SLC43A1 (SLC43A1 Produits)
- Synonymes
- anticorps 2610016F07Rik, anticorps AA986141, anticorps Lat3, anticorps PB39, anticorps Pov1, anticorps R00504, anticorps LAT3, anticorps POV1, anticorps fi47a12, anticorps lat3a, anticorps slc43a1, anticorps wu:fi47a12, anticorps zgc:55850, anticorps wu:fa01a01, anticorps zgc:158383, anticorps solute carrier family 43, member 1, anticorps solute carrier family 43 member 1, anticorps solute carrier family 43 (amino acid system L transporter), member 1a, anticorps solute carrier family 43 (amino acid system L transporter), member 1b, anticorps solute carrier family 43 member 1 L homeolog, anticorps Slc43a1, anticorps SLC43A1, anticorps slc43a1a, anticorps slc43a1b, anticorps slc43a1.L
- Sujet
- SLC43A1 belongs to the system L family of plasma membrane carrier proteins that transports large neutral amino acids.SLC43A1 belongs to the system L family of plasma membrane carrier proteins that transports large neutral amino acids.
- Poids moléculaire
- 61 kDa (MW of target protein)
-