Tricellulin anticorps (Middle Region)
-
- Antigène Voir toutes Tricellulin (MARVELD2) Anticorps
- Tricellulin (MARVELD2)
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Tricellulin est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- MARVELD2 antibody was raised against the middle region of MARVELD2
- Purification
- Affinity purified
- Immunogène
- MARVELD2 antibody was raised using the middle region of MARVELD2 corresponding to a region with amino acids PKTPFVLVVAGLAWITTIIILVLGMSMYYRTILLDSNWWPLTEFGINVAL
- Top Product
- Discover our top product MARVELD2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
MARVELD2 Blocking Peptide, catalog no. 33R-7179, is also available for use as a blocking control in assays to test for specificity of this MARVELD2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MARVELD2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Tricellulin (MARVELD2)
- Autre désignation
- MARVELD2 (MARVELD2 Produits)
- Synonymes
- anticorps Mrvldc2, anticorps BC003296, anticorps MARVD2, anticorps Tric, anticorps Trica, anticorps Tricb, anticorps Tricc, anticorps DFNB49, anticorps MRVLDC2, anticorps MARVEL domain containing 2, anticorps MARVEL (membrane-associating) domain containing 2, anticorps Marveld2, anticorps MARVELD2
- Sujet
- Tight junctions (TJ) prevent leakage of solutes through the paracellular pathway of epithelial cells. MARVELD2, or tricellulin (TRIC), is an integral membrane protein concentrated at the vertically oriented TJ strands of tricellular contacts.
- Poids moléculaire
- 52 kDa (MW of target protein)
- Pathways
- Sensory Perception of Sound, Cell-Cell Junction Organization
-