TSPAN4 anticorps (Middle Region)
-
- Antigène Voir toutes TSPAN4 Anticorps
- TSPAN4 (Tetraspanin 4 (TSPAN4))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TSPAN4 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Tetraspanin 4 antibody was raised against the middle region of TSPAN4
- Purification
- Affinity purified
- Immunogène
- Tetraspanin 4 antibody was raised using the middle region of TSPAN4 corresponding to a region with amino acids YTDKIDRYAQQDLKKGLHLYGTQGNVGLTNAWSIIQTDFRCCGVSNYTDW
- Top Product
- Discover our top product TSPAN4 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Tetraspanin 4 Blocking Peptide, catalog no. 33R-10258, is also available for use as a blocking control in assays to test for specificity of this Tetraspanin 4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSPAN4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TSPAN4 (Tetraspanin 4 (TSPAN4))
- Autre désignation
- Tetraspanin 4 (TSPAN4 Produits)
- Synonymes
- anticorps tspan-4, anticorps DKFZp469K0233, anticorps NAG-2, anticorps NAG2, anticorps TETRASPAN, anticorps TM4SF7, anticorps TSPAN-4, anticorps AI325509, anticorps AI746565, anticorps D130042I01Rik, anticorps Tm4sf7, anticorps Tspan-4, anticorps tetraspanin 4, anticorps tetraspanin 4 S homeolog, anticorps uncharacterized LOC724310, anticorps TSPAN4, anticorps tspan4.S, anticorps tspan4, anticorps LOC724310, anticorps Tspan4
- Sujet
- The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein and is similar in sequence to its family member CD53 antigen. It is known to complex with integrins and other transmembrane 4 superfamily proteins. Alternatively spliced transcript variants encoding different isoforms have been identified.
- Poids moléculaire
- 26 kDa (MW of target protein)
-