CMTM2 anticorps (N-Term)

N° du produit ABIN634911

Détail du produit anti-CMTM2 anticorps

Antigène: CMTM2 (CKLF-Like MARVEL Transmembrane Domain Containing 2 (CMTM2))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CMTM2 est non-conjugé

Application: Western Blotting (WB)

Specificité: CMTM2 antibody was raised against the N terminal of CMTM2

Purification: Affinity purified

Immunogène: CMTM2 antibody was raised using the N terminal of CMTM2 corresponding to a region with amino acids DKPQKAVQDHKEPSDKPQKAVQPKHEVGTRRGCRRYRWELKDSNKEFWLL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CMTM2 Blocking Peptide, catalog no. 33R-2029, is also available for use as a blocking control in assays to test for specificity of this CMTM2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CMTM2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CMTM2

Antigène: CMTM2 (CKLF-Like MARVEL Transmembrane Domain Containing 2 (CMTM2))

Autre désignation: CMTM2 (CMTM2 Produits)

Sujet: CMTM2 belongs to the chemokine-like factor superfamily, a novel family that links the chemokine and the transmembrane 4 superfamilies of signaling molecules. The protein may play an important role in testicular development. This gene belongs to the chemokine-like factor geneuperfamily, a novel family that links the chemokine and the transmembrane 4 superfamilies of signaling molecules. The protein encoded by this gene may play an important role in testicular development.

Poids moléculaire: 27 kDa (MW of target protein)