LST-3TM12 anticorps (Middle Region)

N° du produit ABIN634912

Détail du produit anti-LST-3TM12 anticorps

Antigène: LST-3TM12 (Organic Anion Transporter LST-3b (LST-3TM12))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LST-3TM12 est non-conjugé

Application: Western Blotting (WB)

Specificité: LST-3 TM12 antibody was raised against the middle region of LST-3 M12

Purification: Affinity purified

Immunogène: LST-3 TM12 antibody was raised using the middle region of LST-3 M12 corresponding to a region with amino acids LKTNDKRNQIANLTNRRKYITKNVTGFFQSLKSILTNPLYVIFVIFTLLH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LST-3TM12 Blocking Peptide, catalog no. 33R-5109, is also available for use as a blocking control in assays to test for specificity of this LST-3TM12 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LST-0 M12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LST-3TM12

Antigène: LST-3TM12 (Organic Anion Transporter LST-3b (LST-3TM12))

Autre désignation: LST-3TM12 (LST-3TM12 Produits)

Synonymes: anticorps LST-3, anticorps LST-3TM12, anticorps LST3, anticorps SLC21A21, anticorps solute carrier organic anion transporter family member 1B7 (putative), anticorps SLCO1B7

Sujet: The function of LST-3TM12 protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 71 kDa (MW of target protein)